CST1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human CST1 protein.
Immunogen
CST1 (NP_001889.2, 1 a.a. ~ 141 a.a) full-length human protein.
Sequence
MAQYLSTLLLLLATLAVALAWSPKEEDRIIPGGIYNADLNDEWVQRALHFAISEYNKATKDDYYRRPLRVLRARQQTVGGVNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSFEIYEVPWENRRSLVKSRCQES
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CST1 expression in transfected 293T cell line (H00001469-T01) by CST1 MaxPab polyclonal antibody.
Lane 1: CST1 transfected lysate(15.51 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CST1
Entrez GeneID
1469GeneBank Accession#
NM_001898.2Protein Accession#
NP_001889.2Gene Name
CST1
Gene Alias
-
Gene Description
cystatin SN
Omim ID
123855Gene Ontology
HyperlinkGene Summary
The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a cysteine proteinase inhibitor found in saliva, tears, urine, and seminal fluid. [provided by RefSeq
Other Designations
OTTHUMP00000030444|OTTHUMP00000164184|cystatin 1|cystatin SA-I|cysteine proteinase inhibitor, type 2 family
-
Interactome
-
Disease
-
Publication Reference
-
Cystatin SN Upregulation in Patients with Seasonal Allergic Rhinitis.
Imoto Y, Tokunaga T, Matsumoto Y, Hamada Y, Ono M, Yamada T, Ito Y, Arinami T, Okano M, Noguchi E, Fujieda S.
PLoS One 2013 Aug; 8(8):e67057.
Application:IHC, Human, Nasal .
-
Upregulation of the cysteine protease inhibitor, Cystatin SN, contributes to cell proliferation and cathepsin inhibition in gastric cancer.
Choi EH, Kim JT, Kim JH, Kim SY, Song EY, Kim JW, Kim SY, Yeom YI, Kim IH, Lee HG.
Clinica Chimica Acta 2009 Aug; 406(1-2):45.
Application:IHC-P, WB-Tr, Human, AGS cells, Human gastric cancer.
-
Cystatin SN Upregulation in Patients with Seasonal Allergic Rhinitis.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com