Product Browser

Last updated: 2016/12/11
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CSNK2B purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00001460-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human CSNK2B protein.
  • Immunogen:
  • CSNK2B (NP_001311.3, 1 a.a. ~ 215 a.a) full-length human protein.
  • Sequence:
  • MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CSNK2B expression in transfected 293T cell line (H00001460-T02) by CSNK2B MaxPab polyclonal antibody.

    Lane 1: CSNK2B transfected lysate(23.65 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1460
  • Gene Name:
  • CSNK2B
  • Gene Alias:
  • CK2B,CK2N,CSK2B,G5A,MGC138222,MGC138224
  • Gene Description:
  • casein kinase 2, beta polypeptide
  • Gene Summary:
  • This gene encodes the beta subunit of casein kinase II, a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. [provided by RefSeq
  • Other Designations:
  • Casein kinase II beta subunit,OTTHUMP00000029060,OTTHUMP00000029063,OTTHUMP00000029064,alternative name: G5a, phosvitin,phosvitin
  • RSS
  • YouTube
  • Linkedin
  • Facebook