CSK monoclonal antibody (M01), clone 3A3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CSK.
Immunogen
CSK (NP_004374, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MSAIQAAWPSGTECIAKYNFHGTAEQDLPFCKGDVLTIVAVTKDPNWYKAKNKVGREGIIPANYVQKREGVKAGTKLSLMPWFHGKITREQAERLLYPPE
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CSK monoclonal antibody (M01), clone 3A3. Western Blot analysis of CSK expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Cell lysate)
CSK monoclonal antibody (M01), clone 3A3 Western Blot analysis of CSK expression in HL-60 ( Cat # L014V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CSK expression in transfected 293T cell line by CSK monoclonal antibody (M01), clone 3A3.
Lane 1: CSK transfected lysate(50.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CSK on formalin-fixed paraffin-embedded human colon. [antibody concentration 1 ug/ml]Immunoprecipitation
Immunoprecipitation of CSK transfected lysate using anti-CSK monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CSK MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CSK is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CSK over-expressed 293 cell line, cotransfected with CSK Validated Chimera RNAi ( Cat # H00001445-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CSK monoclonal antibody (M01) clone 3A3 (Cat # H00001445-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CSK
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Targeted Deep Sequencing in Multiple-Affected Sibships of European Ancestry Identifies Rare Deleterious Variants in PTPN22 that Confer Risk for Type 1 Diabetes.
Ge Y, Onengut-Gumuscu S, Quinlan AR, Mackey AJ, Wright JA, Buckner JH, Habib T, Rich SS, Concannon P.
Diabetes 2016 Mar; 65(3):794.
Application:WB-Ce, Human, B-lymphoblastoid cells.
-
Targeted Deep Sequencing in Multiple-Affected Sibships of European Ancestry Identifies Rare Deleterious Variants in PTPN22 that Confer Risk for Type 1 Diabetes.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com