Product Browser

Last updated: 2017/11/12
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CSF3R polyclonal antibody (A01)

  • Catalog # : H00001441-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CSF3R.
  • Immunogen:
  • CSF3R (AAH53585, 25 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAGYPPAIPHNLSCLMN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001441-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1441
  • Gene Name:
  • CSF3R
  • Gene Alias:
  • CD114,GCSFR
  • Gene Description:
  • colony stimulating factor 3 receptor (granulocyte)
  • Gene Summary:
  • The protein encoded by this gene is the receptor for colony stimulating factor 3, a cytokine that controls the production, differentiation, and function of granulocytes. The encoded protein, which is a member of the family of cytokine receptors, may also function in some cell surface adhesion or recognition processes. Four transcript variants encoding four different isoforms have been found for this gene, with three of the isoforms being membrane-bound and the other being secreted and soluble. Mutations in this gene are a cause of Kostmann syndrome, also known as severe congenital neutropenia. [provided by RefSeq
  • Other Designations:
  • CD114 antigen,OTTHUMP00000009703,OTTHUMP00000009704,OTTHUMP00000009705,colony stimulating factor 3 receptor,granulocyte colony stimulating factor receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook