Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CSF3 monoclonal antibody (M03), clone 2C5

  • Catalog # : H00001440-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full length recombinant CSF3.
  • Immunogen:
  • CSF3 (NP_757373, 31 a.a. ~ 207 a.a) recombinant protein.
  • Sequence:
  • MTPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunoprecipitation
  • Immunoprecipitation
  • Immunoprecipitation of CSF3 transfected lysate using anti-CSF3 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CSF3 MaxPab rabbit polyclonal antibody.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1440
  • GeneBank Accession#:
  • N/A
  • Protein Accession#:
  • -
  • Gene Name:
  • CSF3
  • Gene Alias:
  • G-CSF,GCSF,MGC45931
  • Gene Description:
  • colony stimulating factor 3 (granulocyte)
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of granulocytes. The active protein is found extracellularly. Three transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000164327,colony stimulating factor 3,filgrastim,granulocyte colony stimulating factor,lenograstim,pluripoietin
  • RSS
  • YouTube
  • Linkedin
  • Facebook