CSF1 monoclonal antibody (M01), clone 1A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CSF1.
Immunogen
CSF1 (AAH21117, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDK
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CSF1 expression in transfected 293T cell line by CSF1 monoclonal antibody (M01), clone 1A9.
Lane 1: CSF1 transfected lysate(60.1 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CSF1 is approximately 3ng/ml as a capture antibody.ELISA
-
Gene Info — CSF1
Entrez GeneID
1435GeneBank Accession#
BC021117Protein Accession#
AAH21117Gene Name
CSF1
Gene Alias
MCSF, MGC31930
Gene Description
colony stimulating factor 1 (macrophage)
Omim ID
120420Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that controls the production, differentiation, and function of macrophages. The active form of the protein is found extracellularly as a disulfide-linked homodimer, and is thought to be produced by proteolytic cleavage of membrane-bound precursors. The encoded protein may be involved in development of the placenta. Four transcript variants encoding three different isoforms have been found for this gene. [provided by RefSeq
Other Designations
OTTHUMP00000013362|OTTHUMP00000013363|OTTHUMP00000013364|colony stimulating factor 1|macrophage colony stimulating factor
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
miR148b is a major coordinator of breast cancer progression in a relapse-associated microRNA signature by targeting ITGA5, ROCK1, PIK3CA, NRAS, and CSF1.
Cimino D, De Pitta C, Orso F, Zampini M, Casara S, Penna E, Quaglino E, Forni M, Damasco C, Pinatel E, Ponzone R, Romualdi C, Brisken C, De Bortoli M, Biglia N, Provero P, Lanfranchi G, Taverna D.
FASEB Journal 2012 Dec; 27(3):1223.
Application:WB-Ce, Human, 4175 TGL, breast tumor.
-
FMNL2 is a positive regulator of cell motility and metastasis in colorectal carcinoma.
Zhu XL, Zeng YF, Guan J, Li YF, Deng YJ, Bian XW, Ding YQ, Liang L.
The Journal of Pathology 2011 Jul; 224(3):377.
Application:WB-Ce, Human, CRC cell lines SW620, SW480, HT29.
-
Pathway-Based Biomarker Search by High-Throughput Proteomics Profiling of Secretomes.
Lawlor K, Nazarian A, Lacomis L, Tempst P, Villanueva J.
Journal of Proteome Research 2009 Mar; 8(3):1489.
Application:WB, Human, MCF-7, MDA-MB-231 cells.
-
miR148b is a major coordinator of breast cancer progression in a relapse-associated microRNA signature by targeting ITGA5, ROCK1, PIK3CA, NRAS, and CSF1.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com