CRYM monoclonal antibody (M03), clone 6B3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CRYM monoclonal antibody (M03), clone 6B3 Western Blot analysis of CRYM expression in Jurkat ( Cat # L017V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of CRYM expression in transfected 293T cell line by CRYM monoclonal antibody (M03), clone 6B3.
Lane 1: CRYM transfected lysate(33.8 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CRYM on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]
Immunoprecipitation
Immunoprecipitation of CRYM transfected lysate using anti-CRYM monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRYM MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRYM is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CRYM.
Immunogen
CRYM (NP_001879, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
EWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CRYM monoclonal antibody (M03), clone 6B3 Western Blot analysis of CRYM expression in Jurkat ( Cat # L017V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CRYM expression in transfected 293T cell line by CRYM monoclonal antibody (M03), clone 6B3.
Lane 1: CRYM transfected lysate(33.8 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CRYM on formalin-fixed paraffin-embedded human skeletal muscle. [antibody concentration 3 ug/ml]Immunoprecipitation
Immunoprecipitation of CRYM transfected lysate using anti-CRYM monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CRYM MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRYM is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CRYM
Entrez GeneID
1428GeneBank Accession#
NM_001888Protein Accession#
NP_001879Gene Name
CRYM
Gene Alias
DFNA40, THBP
Gene Description
crystallin, mu
Omim ID
123740Gene Ontology
HyperlinkGene Summary
Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq
Other Designations
NADP-regulated thyroid-hormone binding protein|OTTHUMP00000115878
-
Interactome
-
Publication Reference
-
Prognostic Relevance of Thyroid-Hormone-Associated Proteins in Adenoid Cystic Carcinoma of the Head and Neck.
Julia Schnoell, Ulana Kotowski, Bernhard J Jank, Stefan Stoiber, Elisabeth Gurnhofer, Michaela Schlederer, Gregor Heiduschka, Lukas Kenner, Lorenz Kadletz-Wanke.
Journal of Personalized Medicine 2021 Dec; 11(12):1352.
Application：IHC, Human, Human tumor.
-
μ-Crystallin Is Associated with Disease Outcome in Head and Neck Squamous Cell Carcinoma.
Bernhard J Jank, Markus Haas, Julia Schnoell, Michaela Schlederer, Gregor Heiduschka, Lukas Kenner, Lorenz Kadletz-Wanke.
Journal of Personalized Medicine 2021 Dec; 11(12):1330.
Application：IHC-P, Human, Human head and neck squamous cell carcinoma.
-
μ-Crystallin in Mouse Skeletal Muscle Promotes a Shift from Glycolytic toward Oxidative Metabolism.
Christian J Kinney, Andrea O'Neill, Kaila Noland, Weiliang Huang, Joaquin Muriel, Valeriy Lukyanenko, Maureen A Kane, Christopher W Ward, Alyssa F Collier, Joseph A Roche, John C McLenithan, Patrick W Reed, Robert J Bloch.
Current Research in Physiology 2021 Feb; 4:47.
Application：IF, Mouse, Mouse muscle.
-
Overexpression of the double homeodomain protein DUX4c interferes with myofibrillogenesis and induces clustering of myonuclei.
Vanderplanck C, Tassin A, Ansseau E, Charron S, Wauters A, Lancelot C, Vancutsem K, Laoudj-Chenivesse D, Belayew A, Coppee F.
Skeletal Muscle 2018 Jan; 8(1):2.
Application：WB-Ce, Human, FSHD and healthy primary myoblasts.
-
The FSHD Atrophic Myotube Phenotype Is Caused by DUX4 Expression.
Vanderplanck C, Ansseau E, Charron S, Stricwant N, Tassin A, Laoudj-Chenivesse D, Wilton SD, Coppee F, Belayew A.
PLoS One 2011 Oct; 6(10):e26820.
Application：WB-Tr, Mouse, C2C12 cells.
-
Comprehensive expression analysis of FSHD candidate genes at the mRNA and protein level.
Rinse Klooster, Kirsten Straasheijm, Bharati Shah, Janet Sowden, Rune Frants, Charles Thornton, Rabi Tawil, Silvere van der Maarel.
European Journal of Human Genetics 2009 Dec; 17(12):1615.
Application：WB-Ti, Human, Human muscle biopsy samples.
-
Proteomic analysis illuminates a novel structural definition of the claustrum and insula.
Mathur BN, Caprioli RM, Deutch AY.
Cerebral Cortex (New York, N.Y. : 1991) 2009 Jan; 19(10):2372.
-
Abnormal expression of mu-crystallin in facioscapulohumeral muscular dystrophy.
Reed PW, Corse AM, Porter NC, Flanigan KM, Bloch RJ.
Experimental Neurology 2007 Mar; 205(2):583.
Application：WB, Human, Human muscle.
-
Prognostic Relevance of Thyroid-Hormone-Associated Proteins in Adenoid Cystic Carcinoma of the Head and Neck.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com