CRYAB purified MaxPab mouse polyclonal antibody (B01P)

Catalog # H00001410-B01P

Size

Price

Stock

Quantity

Size:50 ug
Price: USD $ 335.00
Stock:
order now, ship in 3 months
abnova-minus
abnova-plus

* The price is valid only in USA. Please select country.

Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
Images
Western Blot (Transfected lysate)
Application

Western Blot (Transfected lysate)

Western Blot analysis of CRYAB expression in transfected 293T cell line (H00001410-T02) by CRYAB MaxPab polyclonal antibody.

Lane 1: CRYAB transfected lysate(20.20 KDa).
Lane 2: Non-transfected lysate.

  • Specifications

    Product Description

    Mouse polyclonal antibody raised against a full-length human CRYAB protein.MaxPab Polyclonal Antibody,MaxPab Polyclonal Antibodies,MaxPab,DNA Immune,DNA Immunization,Immune Technology

    Immunogen

    CRYAB (AAH07008.1, 1 a.a. ~ 175 a.a) full-length human protein.

    Sequence

    MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

    Host

    Mouse

    Reactivity

    Human

    Quality Control Testing

    Antibody reactive against mammalian transfected lysate.

    Storage Buffer

    In 1x PBS, pH 7.4

    Storage Instruction

    Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

  • Applications

    Western Blot (Transfected lysate)

    Western Blot analysis of CRYAB expression in transfected 293T cell line (H00001410-T02) by CRYAB MaxPab polyclonal antibody.

    Lane 1: CRYAB transfected lysate(20.20 KDa).
    Lane 2: Non-transfected lysate.
  • Gene Info — CRYAB

    Entrez GeneID

    1410

    GeneBank Accession#

    BC007008.1

    Protein Accession#

    AAH07008.1

    Gene Name

    CRYAB

    Gene Alias

    CRYA2, CTPP2, HSPB5

    Gene Description

    crystallin, alpha B

    Omim ID

    123590 608810

    Gene Ontology

    Hyperlink

    Gene Summary

    Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Alpha crystallins are composed of two gene products: alpha-A and alpha-B, for acidic and basic, respectively. Alpha crystallins can be induced by heat shock and are members of the small heat shock protein (sHSP also known as the HSP20) family. They act as molecular chaperones although they do not renature proteins and release them in the fashion of a true chaperone; instead they hold them in large soluble aggregates. Post-translational modifications decrease the ability to chaperone. These heterogeneous aggregates consist of 30-40 subunits; the alpha-A and alpha-B subunits have a 3:1 ratio, respectively. Two additional functions of alpha crystallins are an autokinase activity and participation in the intracellular architecture. Alpha-A and alpha-B gene products are differentially expressed; alpha-A is preferentially restricted to the lens and alpha-B is expressed widely in many tissues and organs. Elevated expression of alpha-B crystallin occurs in many neurological diseases; a missense mutation cosegregated in a family with a desmin-related myopathy. [provided by RefSeq

    Other Designations

    alpha crystallin B chain|heat-shock 20 kD like-protein

  • Interactomes
  • Diseases
Contact Info
  • +1-909-264-1399
    +1-909-992-0619
    Toll Free : +1-877-853-6098
  • +1-909-992-3401
4 Products to Compare
Remove All