Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRH (Human) Recombinant Protein (Q01)

  • Catalog # : H00001392-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CRH partial ORF ( AAH11031, 154 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 30.47
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001392-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1392
  • Gene Name:
  • CRH
  • Gene Alias:
  • CRF
  • Gene Description:
  • corticotropin releasing hormone
  • Gene Summary:
  • Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin dificiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition. [provided by RefSeq
  • Other Designations:
  • corticotropin-releasing factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook