CRH monoclonal antibody (M02), clone 2B11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CRH.
Immunogen
CRH (AAH11031, 154 a.a. ~ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (30.47 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CRH expression in transfected 293T cell line by CRH monoclonal antibody (M02), clone 2B11.
Lane 1: CRH transfected lysate(21.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CRH is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — CRH
Entrez GeneID
1392GeneBank Accession#
BC011031Protein Accession#
AAH11031Gene Name
CRH
Gene Alias
CRF
Gene Description
corticotropin releasing hormone
Gene Ontology
HyperlinkGene Summary
Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin dificiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition. [provided by RefSeq
Other Designations
corticotropin-releasing factor
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Screening a small molecule library to identify inhibitors of NF-κB inducing kinase and pro-labor genes in human placenta.
Wang B, Parobchak N, Martin A, Rosen M, Yu LJ, Nguyen M, Gololobova K, Rosen T.
Scientific Reports 2018 Jan; 8(1):1657.
Application:WB-Ce, WB-Ti, Human, Human placentas, Human primary cytotrophoblasts.
-
Negative effects of progesterone receptor isoform-A on human placental activity of the non-canonical NF-κB signaling.
Wang B, Parobchak N, Rosen M, Roche N, Rosen T.
The Journal of Clinical Endocrinology and Metabolism 2014 Feb; 99(2):E320.
Application:WB-Ti, WB-Tr, Huamn, Placenta, CTBs.
-
Glucocorticoid Receptor Signaling Contributes to Constitutive Activation of the Noncanonical NF-κB Pathway in Term Human Placenta.
Wang B, Palomares K, Parobchak N, Cece J, Rosen M, Nguyen A, Rosen T.
Molecular Endocrinology 2012 Dec; 27(2):203.
Application:IHC-P, Human, Human placentas.
-
RelB/NF-κB2 regulates corticotropin-releasing hormone in the human placenta.
Wang B, Parobchak N, Rosen T.
Journal of Molecular Endocrinology 2012 Aug; 26(8):1356.
Application:IHC-P, Human, Human placental tissue samples.
-
Screening a small molecule library to identify inhibitors of NF-κB inducing kinase and pro-labor genes in human placenta.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com