CREM purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human CREM protein.
Immunogen
CREM (NP_001872.3, 1 a.a. ~ 137 a.a) full-length human protein.
Sequence
MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL
Host
Rabbit
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CREM MaxPab rabbit polyclonal antibody. Western Blot analysis of CREM expression in HeLa.Western Blot (Transfected lysate)
Western Blot analysis of CREM expression in transfected 293T cell line (H00001390-T03) by CREM MaxPab polyclonal antibody.
Lane 1: CREM transfected lysate(14.90 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — CREM
Entrez GeneID
1390GeneBank Accession#
NM_001881.2Protein Accession#
NP_001872.3Gene Name
CREM
Gene Alias
ICER, MGC111110, MGC17881, MGC41893, hCREM-2
Gene Description
cAMP responsive element modulator
Omim ID
123812Gene Ontology
HyperlinkGene Summary
This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq
Other Designations
OTTHUMP00000019442|OTTHUMP00000019443|OTTHUMP00000019444|OTTHUMP00000019446|OTTHUMP00000019448|cAMP response element modulator|hCREM 2alpha-b protein|hCREM 2beta-a protein|inducible cAMP early repressor ICER
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com