Product Browser

Last updated: 2017/6/18
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CREM polyclonal antibody (A01)

  • Catalog # : H00001390-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CREM.
  • Immunogen:
  • CREM (NP_853549, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001390-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1390
  • Gene Name:
  • CREM
  • Gene Alias:
  • ICER,MGC111110,MGC17881,MGC41893,hCREM-2
  • Gene Description:
  • cAMP responsive element modulator
  • Gene Summary:
  • This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019442,OTTHUMP00000019443,OTTHUMP00000019444,OTTHUMP00000019446,OTTHUMP00000019448,cAMP response element modulator,hCREM 2alpha-b protein,hCREM 2beta-a protein,inducible cAMP early repressor ICER
  • RSS
  • YouTube
  • Linkedin
  • Facebook