CREBL1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CREBL1 partial ORF ( NP_004372.3, 2 a.a. - 88 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
35.31
Interspecies Antigen Sequence
Mouse (89); Rat (89)
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ATF6B
Entrez GeneID
1388GeneBank Accession#
NM_004381Protein Accession#
NP_004372.3Gene Name
ATF6B
Gene Alias
CREB-RP, CREBL1, FLJ10066, G13
Gene Description
activating transcription factor 6 beta
Omim ID
600984Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a transcription factor in the unfolded protein response (UPR) pathway during ER stress. Either as a homodimer or as a heterodimer with ATF6-alpha, the encoded protein binds to the ER stress response element, interacting with nuclear transcription factor Y to activate UPR target genes. The protein is normally found in the membrane of the endoplasmic reticulum; however, under ER stress, the N-terminal cytoplasmic domain is cleaved from the rest of the protein and translocates to the nucleus. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
Creb-related protein|OTTHUMP00000029433|cAMP responsive element binding protein-like 1|cyclic AMP-dependent transcription factor ATF-6 beta|protein G13
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com