CREBBP monoclonal antibody (M01), clone 2H5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CREBBP is approximately 0.03ng/ml as a capture antibody.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between FGFR1 and CREBBP. HeLa cells were stained with anti-FGFR1 rabbit purified polyclonal 1:1200 and anti-CREBBP mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to CREBBP on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (36.74 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CREBBP.
Immunogen
CREBBP (NP_004371, 951 a.a. ~ 1050 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (86); Rat (87)
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.74 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CREBBP is approximately 0.03ng/ml as a capture antibody.ELISA
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between FGFR1 and CREBBP. HeLa cells were stained with anti-FGFR1 rabbit purified polyclonal 1:1200 and anti-CREBBP mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to CREBBP on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CREBBP
Entrez GeneID
1387GeneBank Accession#
NM_004380Protein Accession#
NP_004371Gene Name
CREBBP
Gene Alias
CBP, KAT3A, RSTS
Gene Description
CREB binding protein
Gene Ontology
HyperlinkGene Summary
This gene is ubiquitously expressed and is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. The protein encoded by this gene has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex. This protein acetylates both histone and non-histone proteins. This protein shares regions of very high sequence similarity with protein p300 in its bromodomain, cysteine-histidine-rich regions, and histone acetyltransferase domain. Mutations in this gene cause Rubinstein-Taybi syndrome (RTS). Chromosomal translocations involving this gene have been associated with acute myeloid leukemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
Other Designations
Rubinstein-Taybi syndrome
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com