CRAT polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CRAT polyclonal antibody (A01). Western Blot analysis of CRAT expression in HepG2.
Western Blot (Cell lysate)
CRAT polyclonal antibody (A01). Western Blot analysis of CRAT expression in PC-12.
Western Blot (Transfected lysate)
Western Blot analysis of CRAT expression in transfected 293T cell line by CRAT polyclonal antibody (A01).
Lane1:CRAT transfected lysate (Predicted MW: 36.74 KDa).
Lane2:Non-transfected lysate.
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CRAT.
Immunogen
CRAT (NP_659006, 445 a.a. ~ 544 a.a) partial recombinant protein with GST tag.
Sequence
AIEDLVSMPDIFMDTSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNAARLAHYLEKALLDMRALLQSHPRAKL
Host
Mouse
Reactivity
Human, Rat
Interspecies Antigen Sequence
Mouse (94); Rat (93)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CRAT polyclonal antibody (A01). Western Blot analysis of CRAT expression in HepG2.Western Blot (Cell lysate)
CRAT polyclonal antibody (A01). Western Blot analysis of CRAT expression in PC-12.Western Blot (Transfected lysate)
Western Blot analysis of CRAT expression in transfected 293T cell line by CRAT polyclonal antibody (A01).
Lane1:CRAT transfected lysate (Predicted MW: 36.74 KDa).
Lane2:Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — CRAT
Entrez GeneID
1384GeneBank Accession#
NM_144782Protein Accession#
NP_659006Gene Name
CRAT
Gene Alias
CAT1
Gene Description
carnitine acetyltransferase
Omim ID
600184Gene Ontology
HyperlinkGene Summary
This gene encodes carnitine acetyltransferase (CRAT), which is a key enzyme in the metabolic pathway in mitochondria, peroxisomes and endoplasmic reticulum. CRAT catalyzes the reversible transfer of acyl groups from an acyl-CoA thioester to carnitine and regulates the ratio of acylCoA/CoA in the subcellular compartments. Alternate splicing results in multiple transcript variants; additional transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq
Other Designations
-
-
Interactome
-
Disease
-
Publication Reference
-
Pathogenic cycle between the endogenous nitric oxide synthase inhibitor asymmetrical dimethylarginine and the leukocyte-derived hemoprotein myeloperoxidase.
von Leitner EC, Klinke A, Atzler D, Slocum JL, Lund N, Kielstein JT, Maas R, Schmidt-Haupt R, Pekarova M, Hellwinkel O, Tsikas D, DAlecy LG, Lau D, Willems S, Kubala L, Ehmke H, Meinertz T, Blankenberg S, Schwedhelm E, Gadegbeku CA, Boger RH, Baldus S, Sydow K.
Circulation 2011 Dec; 124(24):2735.
Application：WB-Ce, Human, Human polymorphonuclear neutrophils.
-
Pathogenic cycle between the endogenous nitric oxide synthase inhibitor asymmetrical dimethylarginine and the leukocyte-derived hemoprotein myeloperoxidase.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com