Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRABP2 (Human) Recombinant Protein (P01)

  • Catalog # : H00001382-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CRABP2 full-length ORF ( NP_001869.1, 1 a.a. - 138 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MPNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPAVEIKQEGDTFYIKTSTTVRTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 42.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001382-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1382
  • Gene Name:
  • CRABP2
  • Gene Alias:
  • CRABP-II,RBP6
  • Gene Description:
  • cellular retinoic acid binding protein 2
  • Gene Summary:
  • A number of specific carrier proteins for members of the vitamin A family have been discovered. Cellular retinoic acid binding proteins (CRABP) are low molecular weight proteins whose precise function remains unknown. The inducibility of the CRABP2 gene suggests that this isoform is important in retinoic acid-mediated regulation of human skin growth and differentiation. It has been postulated that the CRABP2 gene is transcriptionally regulated by a newly synthesized regulatory protein. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000038730,OTTHUMP00000038732,cellular retinoic acid-binding protein 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook