CPS1 monoclonal antibody (M01), clone 8H8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CPS1.
Immunogen
CPS1 (NP_001866, 1400 a.a. ~ 1500 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ANNVPATPVAWPSQEGQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIPLLTNFQVTKLFAEAVQKSRKVDSKSLFHYRQYSAGKAA
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (98); Rat (97)
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.85 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CPS1 monoclonal antibody (M01), clone 8H8 Western Blot analysis of CPS1 expression in HeLa ( Cat # L013V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CPS1 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CPS1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — CPS1
Entrez GeneID
1373GeneBank Accession#
NM_001875Protein Accession#
NP_001866Gene Name
CPS1
Gene Alias
-
Gene Description
carbamoyl-phosphate synthetase 1, mitochondrial
Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is an enzyme that catalyzes the first committed step of the hepatic urea cycle, which is important in the removal of excess urea from cells. There are two isozymes of this enzyme, and the encoded protein is the mitochondrial form. Three transcript variants encoding different isoforms have been found for this gene. The shortest isoform may not be localized to the mitochondrion. [provided by RefSeq
Other Designations
CPSase I|carbamoyl-phosphate synthetase 1|carbamoylphosphate synthetase I
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Identification of a mitochondrial defect gene signature reveals NUPR1 as a key regulator of liver cancer progression.
Lee YK, Jee BA, Kwon SM, Yoon YS, Xu WG, Wang HJ, Wang XW, Thorgeirsson SS, Lee JS, Woo HG, Yoon G.
Hepatology 2015 Oct; 62(4):1174.
Application:WB, Human, Mouse, Rat, HDF, C2C12, H9C2, THLE2, THLE3 cells.
-
Identification of a mitochondrial defect gene signature reveals NUPR1 as a key regulator of liver cancer progression.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com