CLDN7 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CLDN7 full-length ORF ( NP_001298.2, 1 a.a. - 211 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTGMMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAMGGGIIFIVAGLATLVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGALLSCSCPGNESKAGYRAPRSYPKSNSSKEYV
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
48.8
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CLDN7
Entrez GeneID
1366GeneBank Accession#
NM_001307.3Protein Accession#
NP_001298.2Gene Name
CLDN7
Gene Alias
CEPTRL2, CPETRL2, Hs.84359, claudin-1
Gene Description
claudin 7
Omim ID
609131Gene Ontology
HyperlinkGene Summary
Claudins, such as CLDN7, are involved in the formation of tight junctions between epithelial cells. Tight junctions restrict lateral diffusion of lipids and membrane proteins, and thereby physically define the border between the apical and basolateral compartments of epithelial cells (Zheng et al., 2003 [PubMed 14502431]).[supplied by OMIM
Other Designations
Clostridium perfringens enterotoxin receptor-like 2|claudin 9
-
Interactome
-
Pathway
-
Publication Reference
-
Trypsin-2 enhances carcinoma invasion by processing tight junctions and activating ProMT1-MMP.
Vilen ST, Suojanen J, Salas F, Risteli J, Ylipalosaari M, Itkonen O, Koistinen H, Baumann M, Stenman UH, Sorsa T, Salo T, Nyberg P.
Cancer Investigation 2012 Oct; 30(8):583.
Application:Enzyme, Func, Recombinant protein.
-
Trypsin-2 enhances carcinoma invasion by processing tight junctions and activating ProMT1-MMP.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com