Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLDN4 (Human) Recombinant Protein (P01)

  • Catalog # : H00001364-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CLDN4 full-length ORF ( AAH00671, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 48.73
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001364-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1364
  • Gene Name:
  • CLDN4
  • Gene Alias:
  • CPE-R,CPER,CPETR,CPETR1,WBSCR8,hCPE-R
  • Gene Description:
  • claudin 4
  • Gene Summary:
  • This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq
  • Other Designations:
  • Clostridium perfringens enterotoxin receptor 1,Williams-Beuren syndrome chromosomal region 8 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook