Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLDN4 MaxPab rabbit polyclonal antibody (D01)MaxPab

  • Catalog # : H00001364-D01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CLDN4 protein.
  • Immunogen:
  • CLDN4 (NP_001296.1, 1 a.a. ~ 209 a.a) full-length human protein.
  • Sequence:
  • MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Gene Information
  • Entrez GeneID:
  • 1364
  • Gene Name:
  • CLDN4
  • Gene Alias:
  • CPE-R,CPER,CPETR,CPETR1,WBSCR8,hCPE-R
  • Gene Description:
  • claudin 4
  • Gene Summary:
  • This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq
  • Other Designations:
  • Clostridium perfringens enterotoxin receptor 1,Williams-Beuren syndrome chromosomal region 8 protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook