COX15 monoclonal antibody (M01), clone 2D2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of COX15 expression in transfected 293T cell line by COX15 monoclonal antibody (M01), clone 2D2.
Lane 1: COX15 transfected lysate (Predicted MW: 46 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COX15 is 1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (32.45 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant COX15.
Immunogen
COX15 (NP_510870, 92 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.45 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of COX15 expression in transfected 293T cell line by COX15 monoclonal antibody (M01), clone 2D2.
Lane 1: COX15 transfected lysate (Predicted MW: 46 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COX15 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — COX15
Entrez GeneID
1355GeneBank Accession#
NM_078470Protein Accession#
NP_510870Gene Name
COX15
Gene Alias
-
Gene Description
COX15 homolog, cytochrome c oxidase assembly protein (yeast)
Gene Ontology
HyperlinkGene Summary
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3' region. [provided by RefSeq
Other Designations
COX15 homolog|OTTHUMP00000020263|OTTHUMP00000020264|cytochrome c oxidase subunit 15
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com