COX15 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
COX15 polyclonal antibody (A01), Lot # 051128JC01 Western Blot analysis of COX15 expression in 293 ( Cat # L026V1 ).
Western Blot detection against Immunogen (32.82 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant COX15.
Immunogen
COX15 (NP_510870, 92 a.a. ~ 152 a.a) partial recombinant protein with GST tag.
Sequence
LTESGLSMVDWHLIKEMKPPTSQEEWEAEFQRYQQFPEFKILNHDMTLTEFKFIWYMEYSH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (97); Rat (97)
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (32.82 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
COX15 polyclonal antibody (A01), Lot # 051128JC01 Western Blot analysis of COX15 expression in 293 ( Cat # L026V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — COX15
Entrez GeneID
1355GeneBank Accession#
NM_078470Protein Accession#
NP_510870Gene Name
COX15
Gene Alias
-
Gene Description
COX15 homolog, cytochrome c oxidase assembly protein (yeast)
Gene Ontology
HyperlinkGene Summary
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be essential for the biogenesis of COX formation and may function in the hydroxylation of heme O, according to the yeast mutant studies. This protein is predicted to contain 5 transmembrane domains localized in the mitochondrial inner membrane. Alternative splicing of this gene generates two transcript variants diverging in the 3' region. [provided by RefSeq
Other Designations
COX15 homolog|OTTHUMP00000020263|OTTHUMP00000020264|cytochrome c oxidase subunit 15
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com