COX11 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human COX11 protein.
Immunogen
COX11 (AAH05895, 1 a.a. ~ 276 a.a) full-length human protein.
Sequence
MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCSLRARHPALQPPRRPKSSNPFTRAQEEERRWQNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRVKNPTDKPVIGISTYNIVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEGHKLPVPGYN
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (83); Rat (83)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of COX11 expression in transfected 293T cell line (H00001353-T01) by COX11 MaxPab polyclonal antibody.
Lane 1: COX11 transfected lysate(30.47 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — COX11
Entrez GeneID
1353GeneBank Accession#
BC005895Protein Accession#
AAH05895Gene Name
COX11
Gene Alias
COX11P
Gene Description
COX11 homolog, cytochrome c oxidase assembly protein (yeast)
Omim ID
603648Gene Ontology
HyperlinkGene Summary
Cytochrome c oxidase (COX), the terminal component of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. This component is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes a protein which is not a structural subunit, but may be a heme A biosynthetic enzyme involved in COX formation, according to the yeast mutant studies. However, the studies in Rhodobacter sphaeroides suggest that this gene is not required for heme A biosynthesis, but required for stable formation of the Cu(B) and magnesium centers of COX. This human protein is predicted to contain a transmembrane domain localized in the mitochondrial inner membrane. Multiple transcript variants encoding different isoforms have been found for this gene. A related pseudogene has been found on chromosome 6. [provided by RefSeq
Other Designations
COX11 homolog|cytochrome c oxidase assembly protein COX11|cytochrome c oxidase subunit 11
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com