COX5B purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
COX5B MaxPab polyclonal antibody. Western Blot analysis of COX5B expression in human pancreas.
Western Blot (Cell lysate)
COX5B MaxPab polyclonal antibody. Western Blot analysis of COX5B expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of COX5B expression in transfected 293T cell line (H00001329-T03) by COX5B MaxPab polyclonal antibody.
Lane1:COX5B transfected lysate(14.19 KDa).
Lane2:Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to COX5B on HeLa cell. [antibody concentration 10 ug/ml]
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human COX5B protein.
Immunogen
COX5B (NP_001853.2, 1 a.a. ~ 129 a.a) full-length human protein.
Sequence
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
COX5B MaxPab polyclonal antibody. Western Blot analysis of COX5B expression in human pancreas.Western Blot (Cell lysate)
COX5B MaxPab polyclonal antibody. Western Blot analysis of COX5B expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of COX5B expression in transfected 293T cell line (H00001329-T03) by COX5B MaxPab polyclonal antibody.
Lane1:COX5B transfected lysate(14.19 KDa).
Lane2:Non-transfected lysate.
Immunofluorescence
Immunofluorescence of purified MaxPab antibody to COX5B on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — COX5B
Entrez GeneID
1329GeneBank Accession#
NM_001862.2Protein Accession#
NP_001853.2Gene Name
COX5B
Gene Alias
COXVB
Gene Description
cytochrome c oxidase subunit Vb
Omim ID
123866Gene Ontology
HyperlinkGene Summary
Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. [provided by RefSeq
Other Designations
cytochrome c oxidase polypeptide VB, mitochondrial
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com