Product Browser

Last updated: 2017/9/24
  • Related Product Showcase
  • By Research Area

  • By Disease

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COX5B purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00001329-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human COX5B protein.
  • Immunogen:
  • COX5B (NP_001853.2, 1 a.a. ~ 129 a.a) full-length human protein.
  • Sequence:
  • MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLDPYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHYKLVPQQLAH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • COX5B MaxPab polyclonal antibody. Western Blot analysis of COX5B expression in human pancreas.
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • COX5B MaxPab polyclonal antibody. Western Blot analysis of COX5B expression in HepG2.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of COX5B expression in transfected 293T cell line (H00001329-T03) by COX5B MaxPab polyclonal antibody.

    Lane1:COX5B transfected lysate(14.19 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1329
  • Gene Name:
  • COX5B
  • Gene Alias:
  • COXVB
  • Gene Description:
  • cytochrome c oxidase subunit Vb
  • Gene Summary:
  • Cytochrome C oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit Vb of the human mitochondrial respiratory chain enzyme. [provided by RefSeq
  • Other Designations:
  • cytochrome c oxidase polypeptide VB, mitochondrial
  • RSS
  • YouTube
  • Linkedin
  • Facebook