Product Browser

Last updated: 2016/12/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CORT (Human) Recombinant Protein (P01)

  • Catalog # : H00001325-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CORT full-length ORF ( NP_001293.2, 1 a.a. - 155 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MYRHKNSWRLGLKYPPSSKEETQVPKTLISGLPGRKSSSRVGEKLQSAHKMPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQASAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 43.6
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001325-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1325
  • Gene Name:
  • CORT
  • Gene Alias:
  • CST-14,CST-17,CST-29
  • Gene Description:
  • cortistatin
  • Gene Summary:
  • The product of this gene is a neuropeptide with strong structural similarity to somatostatin. It binds to all known somatostatin receptors, and shares many pharmacological and functional properties with somatostatin, including the depression of neuronal activity. However, it also has many properties distinct from somatostatin, such as induction of slow-wave sleep, apparently by antagonism of the excitatory effects of acetylcholine on the cortex, reduction of locomotor activity, and activation of cation selective currents not responsive to somatostatin. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000001901,OTTHUMP00000044365,cortistatin-14,cortistatin-17,cortistatin-29,preprocortistatin
  • RSS
  • YouTube
  • Linkedin
  • Facebook