KLF6 monoclonal antibody (M01), clone 1A9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of KLF6 expression in transfected 293T cell line by KLF6 monoclonal antibody (M01), clone 1A9.
Lane 1: KLF6 transfected lysate(28.71 KDa).
Lane 2: Non-transfected lysate.
Western Blot detection against Immunogen (54.34 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant KLF6.
Immunogen
KLF6 (AAH04301.1, 1 a.a. ~ 260 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDVLPMCSIFQELQIVHETGYFSALPSLEEYWQQTCLELERYLQSEPCYVSASEIKFDSQEDLWTKIILAREKKEESELKISSSPPEDTLISPSFCYNLETNSLNSDVSSESSDSSEELSPTAKFTSDPIGEVLVSSGKLGSSVTSAPPSSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFNGCRKVYTKSSHLKAHQRTHTGEKPYRCSWEGCEWRFARSDELTRHFRKHTGAKPF
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (54.34 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of KLF6 expression in transfected 293T cell line by KLF6 monoclonal antibody (M01), clone 1A9.
Lane 1: KLF6 transfected lysate(28.71 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
-
Gene Info — KLF6
Entrez GeneID
1316GeneBank Accession#
BC004301.1Protein Accession#
AAH04301.1Gene Name
KLF6
Gene Alias
BCD1, COPEB, CPBP, DKFZp686N0199, GBF, PAC1, ST12, ZF9
Gene Description
Kruppel-like factor 6
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the Kruppel-like family of transcription factors. The zinc finger protein is a transcriptional activator, and functions as a tumor suppressor. Multiple transcript variants encoding different isoforms have been found for this gene, some of which are implicated in carcinogenesis. [provided by RefSeq
Other Designations
B-cell derived 1|core promoter element binding protein|core promoter element-binding protein, N-terminus truncated|prostate adenocarcinoma-1|protooncogene BCD1|suppression of tumorigenicity 12 (prostate)
-
Interactome
-
Disease
-
Publication Reference
-
Caffeic acid phenethyl ester causes p21 induction, Akt signaling reduction, and growth inhibition in PC-3 human prostate cancer cells.
Lin HP, Jiang SS, Chuu CP.
PLoS One 2012 Feb; 7(2):e31286.
Application：WB-Ce, Human, PC-3 cells.
-
Caffeic acid phenethyl ester causes p21 induction, Akt signaling reduction, and growth inhibition in PC-3 human prostate cancer cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com