COMT monoclonal antibody (M01), clone 1G4-1A1
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
COMT monoclonal antibody (M01), clone 1G4-1A1 Western Blot analysis of COMT expression in A-431 ( Cat # L015V1 ).
Western Blot (Transfected lysate)
Western Blot analysis of COMT expression in transfected 293T cell line by COMT monoclonal antibody (M01), clone 1G4-1A1.
Lane 1: COMT transfected lysate(24.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COMT is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (45.76 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant COMT.
Immunogen
COMT (AAH00419.2, 1 a.a. ~ 182 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Host
Mouse
Reactivity
Human
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (45.76 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
COMT monoclonal antibody (M01), clone 1G4-1A1 Western Blot analysis of COMT expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of COMT expression in transfected 293T cell line by COMT monoclonal antibody (M01), clone 1G4-1A1.
Lane 1: COMT transfected lysate(24.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged COMT is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — COMT
Entrez GeneID
1312GeneBank Accession#
BC000419Protein Accession#
AAH00419.2Gene Name
COMT
Gene Alias
-
Gene Description
catechol-O-methyltransferase
Gene Ontology
HyperlinkGene Summary
Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq
Other Designations
-
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com