Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COMP (Human) Recombinant Protein (P01)

  • Catalog # : H00001311-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human COMP full-length ORF (BAC11031.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGVPLRGLPAGVQRPHPPGRGAGFRQGQQAGLHGHQRV
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.2
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1311
  • Gene Name:
  • COMP
  • Gene Alias:
  • EDM1,EPD1,MED,MGC131819,MGC149768,PSACH,THBS5
  • Gene Description:
  • cartilage oligomeric matrix protein
  • Gene Summary:
  • The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Mutations can cause the osteochondrodysplasias pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED). [provided by RefSeq
  • Other Designations:
  • cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple),cartilage oligomeric matrix protein(pseudoachondroplasia, epiphyseal dysplasia 1, multiple),pseudoachondroplasia (epiphyseal dysplasia 1, multiple),thrombospondin
  • RSS
  • YouTube
  • Linkedin
  • Facebook