Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COL19A1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001310-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human COL19A1 partial ORF ( NP_001849, 27 a.a. - 114 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • RDKTEESCPILRIEGHQLTYDNINKLEVSGFDLGDSFSLRRAFCESDKTCFKLGSALLIRDTIKIFPKGLPEEYSVAAMFRVRRNAKK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 35.42
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001310-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1310
  • Gene Name:
  • COL19A1
  • Gene Alias:
  • COL9A1L,D6S228E
  • Gene Description:
  • collagen, type XIX, alpha 1
  • Gene Summary:
  • This gene encodes the alpha chain of type XIX collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Although the function of this collagen is not known, other members of this collagen family are found in association with fibril-forming collagens such as type I and II, and serve to maintain the integrity of the extracellular matrix. The transcript produced from this gene has an unusually large 3' UTR which has not been completely sequenced. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016695,OTTHUMP00000039279,a1 chain of type XIX collagen,alpha 1 type XIX collagen,collagen XIX, alpha-1 polypeptide,collagen alpha 1 (Y) chain
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook