COL9A3 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
COL9A3 MaxPab rabbit polyclonal antibody. Western Blot analysis of COL9A3 expression in human kidney.
Western Blot (Transfected lysate)
Western Blot analysis of COL9A3 expression in transfected 293T cell line (H00001299-T02) by COL9A3 MaxPab polyclonal antibody.
Lane 1: COL9A3 transfected lysate(63.60 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human COL9A3 protein.
Immunogen
COL9A3 (NP_001844.3, 1 a.a. ~ 684 a.a) full-length human protein.
Sequence
MAGPRACAPLLLLLLLGELLAAAGAQRVGLPGPPGPPGPPGKPGQDGIDGEAGPPGLPGPPGPKGAPGKPGKPGEAGLPGLPGVDGLTGRDGPPGPKGAPGERGSLGPPGPPGLGGKGLPGPPGEAGVSGPPGGIGLRGPPGPSGLPGLPGPPGPPGPPGHPGVLPEGATDLQCPSICPPGPPGPPGMPGFKGPTGYKGEQGEVGKDGEKGDPGPPGPAGLPGSVGLQGPRGLRGLPGPLGPPGDRGPIGFRGPPGIPGAPGKAGDRGERGPEGFRGPKGDLGRPGPKGTPGVAGPSGEPGMPGKDGQNGVPGLDGQKGEAGRNGAPGEKGPNGLPGLPGRAGSKGEKGERGRAGELGEAGPSGEPGVPGDAGMPGERGEAGHRGSAGALGPQGPPGAPGVRGFQGQKGSMGDPGLPGPQGLRGDVGDRGPGGAAGPKGDQGIAGSDGLPGDKGELGPSGLVGPKGESGSRGELGPKGTQGPNGTSGVQGVPGPPGPLGLQGVPGVPGITGKPGVPGKEASEQRIRELCGGMISEQIAQLAAHLRKPLAPGSIGRPGPAGPPGPPGPPGSIGHPGARGPPGYRGPTGELGDPGPRGNQGDRGDKGAAGAGLDGPEGDQGPQGPQGVPGTSKDGQDGAPGEPGPPGDPGLPGAIGAQGTPGICDTSACQGAVLGGVGEKSGSRSS
Host
Rabbit
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93)
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
COL9A3 MaxPab rabbit polyclonal antibody. Western Blot analysis of COL9A3 expression in human kidney.Western Blot (Transfected lysate)
Western Blot analysis of COL9A3 expression in transfected 293T cell line (H00001299-T02) by COL9A3 MaxPab polyclonal antibody.
Lane 1: COL9A3 transfected lysate(63.60 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — COL9A3
Entrez GeneID
1299GeneBank Accession#
BC011705.2Protein Accession#
NP_001844.3Gene Name
COL9A3
Gene Alias
DJ885L7.4.1, EDM3, FLJ90759, IDD, MED
Gene Description
collagen, type IX, alpha 3
Gene Ontology
HyperlinkGene Summary
This gene encodes one of the three alpha chains of type IX collagen, the major collagen component of hyaline cartilage. Type IX collagen, a heterotrimeric molecule, is usually found in tissues containing type II collagen, a fibrillar collagen. Mutations in this gene are associated with multiple epiphyseal dysplasia. [provided by RefSeq
Other Designations
OTTHUMP00000031507|alpha 3 type IX collagen|collagen IX, alpha-3 polypeptide|collagen type IX proteoglycan
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com