Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COL8A2 monoclonal antibody (M01), clone 1F4

  • Catalog # : H00001296-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant COL8A2.
  • Immunogen:
  • COL8A2 (NP_005193.1, 626 a.a. ~ 696 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • VHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001296-M01
    Western Blot detection against Immunogen (33.55 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • COL8A2 monoclonal antibody (M01), clone 1F4. Western Blot analysis of COL8A2 expression in K-562.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1296
  • Gene Name:
  • COL8A2
  • Gene Alias:
  • FECD,FLJ00201,MGC116970,MGC116972,PPCD,PPCD2
  • Gene Description:
  • collagen, type VIII, alpha 2
  • Other Designations:
  • OTTHUMP00000009029,OTTHUMP00000194904,collagen VIII, alpha-2 polypeptide,dJ665N4.1 (collagen type VIII alpha 2)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook