Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

COL1A2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001278-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human COL1A2 partial ORF ( AAH54498.1, 1257 a.a. - 1366 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 37.95
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001278-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1278
  • Gene Name:
  • COL1A2
  • Gene Alias:
  • OI4
  • Gene Description:
  • collagen, type I, alpha 2
  • Gene Summary:
  • This gene encodes the pro-alpha2 chain of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIB, recessive Ehlers-Danlos syndrome Classical type, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for the alpha1 chain of type I collagen (COL1A1) reflecting the different role of alpha2 chains in matrix integrity. Three transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene. [provided by R. Dalgleish
  • Other Designations:
  • alpha 2 type I collagen,alpha 2(I)-collagen,alpha-2 collagen type I,collagen I, alpha-2 polypeptide,collagen of skin, tendon and bone, alpha-2 chain,type I procollagen
  • RSS
  • YouTube
  • Linkedin
  • Facebook