COL1A2 monoclonal antibody (M03), clone 7E11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant COL1A2.
Immunogen
COL1A2 (AAH54498.1, 1257 a.a. ~ 1366 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MRLLANYASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWGKTIIEYKTNKPSRLPFLDIAPLDIGGADQEFFVDIGPVCFK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.95 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — COL1A2
Entrez GeneID
1278GeneBank Accession#
BC054498Protein Accession#
AAH54498.1Gene Name
COL1A2
Gene Alias
OI4
Gene Description
collagen, type I, alpha 2
Gene Ontology
HyperlinkGene Summary
This gene encodes the pro-alpha2 chain of type I collagen whose triple helix comprises two alpha1 chains and one alpha2 chain. Type I is a fibril-forming collagen found in most connective tissues and is abundant in bone, cornea, dermis and tendon. Mutations in this gene are associated with osteogenesis imperfecta types I-IV, Ehlers-Danlos syndrome type VIIB, recessive Ehlers-Danlos syndrome Classical type, idiopathic osteoporosis, and atypical Marfan syndrome. Symptoms associated with mutations in this gene, however, tend to be less severe than mutations in the gene for the alpha1 chain of type I collagen (COL1A1) reflecting the different role of alpha2 chains in matrix integrity. Three transcripts, resulting from the use of alternate polyadenylation signals, have been identified for this gene. [provided by R. Dalgleish
Other Designations
alpha 2 type I collagen|alpha 2(I)-collagen|alpha-2 collagen type I|collagen I, alpha-2 polypeptide|collagen of skin, tendon and bone, alpha-2 chain|type I procollagen
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Development and systematic evaluation of decellularization protocols in different application models for diaphragmatic tissue engineering.
Marco N Andreas, Agnes K Boehm, Peter Tang, Simon Moosburner, Oliver Klein, Assal Daneshgar, Joseph M G V Gaßner, Nathanael Raschzok, Luna Haderer, Dag Wulsten, Jens-Carsten Rückert, Simone Spuler, Johann Pratschke, Igor M Sauer, Karl H Hillebrandt.
Biomaterials Advances 2023 Oct; 153:213493.
Application:IHC, Rat, Rat Diaphragm collagen.
-
Solid fraction determines stiffness and viscosity in decellularized pancreatic tissues.
Joachim Snellings, Eriselda Keshi, Peter Tang, Assal Daneshgar, Esther C Willma, Luna Haderer, Oliver Klein, Felix Krenzien, Thomas Malinka, Patrick Asbach, Johann Pratschke, Igor M Sauer, Jürgen Braun, Ingolf Sack, Karl Hillebrandt.
Biomaterials Advances 2022 Aug; 139:212999.
Application:IHC-P, Pig, Pig pancreas.
-
Engineering an endothelialized, endocrine Neo-Pancreas: evaluation of islet functionality in an ex vivo model.
Hannah Everwien, Eriselda Keshi, Karl H Hillebrandt, Barbara Ludwig, Marie Weinhart, Peter Tang, Anika S Beierle, Hendrik Napierala, Joseph Mgv Gassner, Nicolai Seiffert, Simon Moosburner, Dominik Geisel, Anja Reutzel-Selke, Benjamin Strücker, Johann Pratschke, Nils Haep, Igor M Sauer.
Acta Biomaterialia 2020 Nov; 117:213.
Application:IHC-P, Rat, Rat liver.
-
Magnetic resonance elastography quantification of the solid-to-fluid transition of liver tissue due to decellularization.
Hannah Everwien, Angela Ariza de Schellenberger, Nils Haep, Heiko Tzschätzsch, Johann Pratschke, Igor M Sauer, Jürgen Braun, Karl H Hillebrandt, Ingolf Sack.
Journal of the Mechanical Behavior of Biomedical Materials 2020 Apr; 104:103640.
Application:IHC-P, Rat, Rat liver.
-
Development and systematic evaluation of decellularization protocols in different application models for diaphragmatic tissue engineering.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com