Product Browser

Last updated: 2017/9/17
  • Related Product Showcase
  • By Research Area

  • By Pathway

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CNTFR polyclonal antibody (A01)

  • Catalog # : H00001271-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CNTFR.
  • Immunogen:
  • CNTFR (NP_671693, 47 a.a. ~ 158 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELGHSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFNVTVLHGSKIMVCEKDP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001271-A01
    Western Blot detection against Immunogen (38.43 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CNTFR polyclonal antibody (A01), Lot # 060501JCS1 Western Blot analysis of CNTFR expression in HeLa ( Cat # L013V1 ).
  • PDF DownloadProtocol Download
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CNTFR polyclonal antibody (A01), Lot # 060501JCS1. Western Blot analysis of CNTFR expression in A-431.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1271
  • Gene Name:
  • CNTFR
  • Gene Alias:
  • MGC1774
  • Gene Description:
  • ciliary neurotrophic factor receptor
  • Gene Summary:
  • This gene encodes a hematopoeitin/interferon-class receptor belonging to the cytokine superfamily of receptors. The encoded gene product represents the CNTF-specific alpha subunit of a heterotrimer forming the CNTF receptor complex, which also includes LIFR and gp130. The receptor is attached to the membrane by a glycosyl-phosphatidylinositol linkage and contains an immunoglobulin-like C2-type domain and a fibronectin type-III domain. Signal transduction requires that CNTF bind first to this alpha component, which permits the recruitment of gp130 and LIFR beta to form the tripartite receptor complex. Signal transduction stimulates gene expression, cell survival or differentiation in a variety of neuronal cell types. Alternative splicing has been observed at this locus and two variants, both encoding the same protein, have been identified. [provided by RefSeq
  • Other Designations:
  • CNTFR alpha,OTTHUMP00000021270,OTTHUMP00000021271,ciliary neurotrophic factor receptor alpha
  • RSS
  • YouTube
  • Linkedin
  • Facebook