Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CNN3 monoclonal antibody (M03), clone 2C7

  • Catalog # : H00001266-M03
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a full-length recombinant CNN3.
  • Immunogen:
  • CNN3 (NP_001830.1, 1 a.a. ~ 329 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG2a Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001266-M03
    Western Blot detection against Immunogen (62.8 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CNN3 monoclonal antibody (M03), clone 2C7. Western Blot analysis of CNN3 expression in HepG2.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of CNN3 expression in transfected 293T cell line by CNN3 monoclonal antibody (M03), clone 2C7.

    Lane 1: CNN3 transfected lysate (Predicted MW: 36.4 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1266
  • Gene Name:
  • CNN3
  • Gene Alias:
  • -
  • Gene Description:
  • calponin 3, acidic
  • Gene Summary:
  • This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. [provided by RefSeq
  • Other Designations:
  • calponin 3,calponin, acidic,dJ639P13.2.2 (acidic calponin 3)
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook