CNN3 monoclonal antibody (M01), clone 4C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CNN3 monoclonal antibody (M01), clone 4C4. Western Blot analysis of CNN3 expression in HepG2.
Western Blot (Transfected lysate)
Western Blot analysis of CNN3 expression in transfected 293T cell line by CNN3 monoclonal antibody (M01), clone 4C4.
Lane 1: CNN3 transfected lysate (Predicted MW: 36.4 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CNN3 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (62.8 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant CNN3.
Immunogen
CNN3 (NP_001830.1, 1 a.a. ~ 329 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MTHFNKGPSYGLSAEVKNKIASKYDHQAEEDLRNWIEEVTGMSIGPNFQLGLKDGIILCELINKLQPGSVKKVNESSLNWPQLENIGNFIKAIQAYGMKPHDIFEANDLFENGNMTQVQTTLVALAGLAKTKGFHTTIDIGVKYAEKQTRRFDEGKLKAGQSVIGLQMGTNKCASQAGMTAYGTRRHLYDPKMQTDKPFDQTTISLQMGTNKGASQAGMLAPGTRRDIYDQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (62.8 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CNN3 monoclonal antibody (M01), clone 4C4. Western Blot analysis of CNN3 expression in HepG2.Western Blot (Transfected lysate)
Western Blot analysis of CNN3 expression in transfected 293T cell line by CNN3 monoclonal antibody (M01), clone 4C4.
Lane 1: CNN3 transfected lysate (Predicted MW: 36.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CNN3 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — CNN3
Entrez GeneID
1266GeneBank Accession#
NM_001839.2Protein Accession#
NP_001830.1Gene Name
CNN3
Gene Alias
-
Gene Description
calponin 3, acidic
Omim ID
602374Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. [provided by RefSeq
Other Designations
calponin 3|calponin, acidic|dJ639P13.2.2 (acidic calponin 3)
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com