CNN3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
CNN3 polyclonal antibody (A01), Lot # 060111JC01 Western Blot analysis of CNN3 expression in HepG2 ( Cat # L019V1 ).
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant CNN3.
Immunogen
CNN3 (NP_001830, 230 a.a. ~ 329 a.a) partial recombinant protein with GST tag.
Sequence
DQKLTLQPVDNSTISLQMGTNKVASQKGMSVYGLGRQVYDPKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CNN3 polyclonal antibody (A01), Lot # 060111JC01 Western Blot analysis of CNN3 expression in HepG2 ( Cat # L019V1 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — CNN3
Entrez GeneID
1266GeneBank Accession#
NM_001839Protein Accession#
NP_001830Gene Name
CNN3
Gene Alias
-
Gene Description
calponin 3, acidic
Omim ID
602374Gene Ontology
HyperlinkGene Summary
This gene encodes a protein with a markedly acidic C terminus; the basic N-terminus is highly homologous to the N-terminus of a related gene, CNN1. Members of the CNN gene family all contain similar tandemly repeated motifs. This encoded protein is associated with the cytoskeleton but is not involved in contraction. [provided by RefSeq
Other Designations
calponin 3|calponin, acidic|dJ639P13.2.2 (acidic calponin 3)
-
Interactome
-
Disease
-
Publication Reference
-
Rock-dependent calponin 3 phosphorylation regulates myoblast fusion.
Shibukawa Y, Yamazaki N, Daimon E, Wada Y.
Experimental Cell Research 2012 Dec; 319(5):633.
Application：IP-WB, Mouse, C2C12 mouse myoblasts, satellite cells.
-
Calponin 3 Regulates Actin Cytoskeleton Rearrangement in Trophoblastic Cell Fusion.
Shibukawa Y, Yamazaki N, Kumasawa K, Daimon E, Tajiri M, Okada Y, Ikawa M, Wada Y.
Molecular Biology of the Cell 2010 Nov; 21(22):3973.
Application：WB-Ce, WB-Tr, Human, BeWo, HEK 293, BeWo/HEK 293 cells.
-
Rock-dependent calponin 3 phosphorylation regulates myoblast fusion.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com