Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LTB4R (Human) Recombinant ProteinProteoliposome

  • Catalog # : H00001241-G01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LTB4R full-length ORF (ABW03628.1) recombinant protein without tag.
  • Sequence:
  • MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPFKLNELN
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 38.72
  • Form:
  • Liquid
  • Recommend Usage:
  • Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
  • Storage Buffer:
  • 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Publication Reference
  • Publication Reference
  • Applications
  • Antibody Production
  • Functional Study
  • Recommended usage only, not validated yet.
  • Compound Screening
  • Recommended usage only, not validated yet.
  • Application Image
  • Antibody Production
  • Functional Study
  • Compound Screening
  • Gene Information
  • Entrez GeneID:
  • 1241
  • Gene Name:
  • LTB4R
  • Gene Alias:
  • BLT1,BLTR,CMKRL1,GPR16,LTB4R1,LTBR1,P2RY7,P2Y7
  • Gene Description:
  • leukotriene B4 receptor
  • Other Designations:
  • G protein-coupled receptor 16,OTTHUMP00000164789,OTTHUMP00000164790,chemokine receptor-like 1,purinergic receptor P2Y, G-protein coupled, 7
  • RSS
  • YouTube
  • Linkedin
  • Facebook