Product Browser

Last updated: 2017/8/20
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCR2 monoclonal antibody (M01A), clone 4D12

  • Catalog # : H00001231-M01A
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant CCR2.
  • Immunogen:
  • CCR2 (NP_000639, 1 a.a. ~ 42 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgM Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001231-M01A
    Western Blot detection against Immunogen (30.36 KDa) .
  • Storage Buffer:
  • In ascites fluid
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CCR2 monoclonal antibody (M01A), clone 4D12 Western Blot analysis of CCR2 expression in HepG2 ( Cat # L019V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1231
  • Gene Name:
  • CCR2
  • Gene Alias:
  • CC-CKR-2,CCR2A,CCR2B,CD192,CKR2,CKR2A,CKR2B,CMKBR2,MCP-1-R
  • Gene Description:
  • chemokine (C-C motif) receptor 2
  • Other Designations:
  • MCP-1 receptor,chemokine (C-C) receptor 2,monocyte chemoattractant protein 1 receptor,monocyte chemotactic protein 1 receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook