Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLTC polyclonal antibody (A01)

  • Catalog # : H00001213-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CLTC.
  • Immunogen:
  • CLTC (NP_004850, 232 a.a. ~ 340 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001213-A01
    Western Blot detection against Immunogen (38.1 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • CLTC polyclonal antibody (A01), Lot # O51130JC01 Western Blot analysis of CLTC expression in MES-SA/Dx5 ( Cat # L021V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1213
  • Gene Name:
  • CLTC
  • Gene Alias:
  • CHC,CHC17,CLH-17,CLTCL2,Hc,KIAA0034
  • Gene Description:
  • clathrin, heavy chain (Hc)
  • Gene Summary:
  • Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains. [provided by RefSeq
  • Other Designations:
  • clathrin heavy chain 1,clathrin, heavy polypeptide (Hc),clathrin, heavy polypeptide-like 2
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook