CLIC1 monoclonal antibody (M02), clone 3F9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CLIC1.
Immunogen
CLIC1 (AAH64527.1, 1 a.a. ~ 241 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (52.25 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CLIC1 monoclonal antibody (M02), clone 3F9 Western Blot analysis of CLIC1 expression in 293 ( Cat # L026V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CLIC1 expression in transfected 293T cell line by CLIC1 monoclonal antibody (M02), clone 3F9.
Lane 1: CLIC1 transfected lysate(26.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to CLIC1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 0.15 ug/ml]ELISA
-
Gene Info — CLIC1
Entrez GeneID
1192GeneBank Accession#
BC064527Protein Accession#
AAH64527.1Gene Name
CLIC1
Gene Alias
G6, NCC27
Gene Description
chloride intracellular channel 1
Omim ID
602872Gene Ontology
HyperlinkGene Summary
Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq
Other Designations
OTTHUMP00000029131|OTTHUMP00000029133|OTTHUMP00000029137|OTTHUMP00000174486|RNCC protein|chloride channel ABP|nuclear chloride ion channel protein|p64CLCP
-
Interactome
-
Disease
-
Publication Reference
-
Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle.
Chaze T, Meunier B, Chambon C, Jurie C, Picard B.
Animal 2009 Jul; 3(7):980.
Application:WB-Ti, Bovine, Bovine foetal muscles.
-
Proteome dynamics during contractile and metabolic differentiation of bovine foetal muscle.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com