Product Browser

Last updated: 2017/4/23
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLU polyclonal antibody (A01)

  • Catalog # : H00001191-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CLU.
  • Immunogen:
  • CLU (NP_001822, 402 a.a. ~ 501 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • WKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001191-A01
    Western Blot detection against Immunogen (37.11 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1191
  • Gene Name:
  • CLU
  • Gene Alias:
  • AAG4,APOJ,CLI,KUB1,MGC24903,SGP-2,SGP2,SP-40,TRPM-2,TRPM2
  • Gene Description:
  • clusterin
  • Other Designations:
  • OTTHUMP00000128311,aging-associated protein 4,apolipoprotein J,clusterin (complement lysis inhibitor, SP-40,40, sulfated glycoprotein 2, testosterone-repressed prostate message 2, apolipoprotein J),complement lysis inhibitor,complement-associated protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook