Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLCA1 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001179-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CLCA1 partial ORF ( NP_001276, 677 a.a. - 776 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • ALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAP
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 36.74
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001179-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1179
  • Gene Name:
  • CLCA1
  • Gene Alias:
  • CACC,CACC1,CLCRG1,FLJ95147,GOB5
  • Gene Description:
  • chloride channel regulator 1
  • Gene Summary:
  • This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine. [provided by RefSeq
  • Other Designations:
  • CLCA family member 1, chloride channel regulator,OTTHUMP00000011907,calcium-activated chloride channel protein 1,calcium-dependent chloride channel-1,chloride channel, calcium activated, family member 1
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook