AP2S1 monoclonal antibody (M01), clone 3E4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of AP2S1 expression in transfected 293T cell line by AP2S1 monoclonal antibody (M01), clone 3E4.
Lane 1: AP2S1 transfected lysate(17 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AP2S1 is 0.3 ng/ml as a capture antibody.
RNAi Knockdown (Antibody validated)
Western blot analysis of AP2S1 over-expressed 293 cell line, cotransfected with AP2S1 Validated Chimera RNAi ( Cat # H00001175-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AP2S1 monoclonal antibody (M01), clone 3E4 (Cat # H00001175-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Western Blot detection against Immunogen (41.36 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant AP2S1.
Immunogen
AP2S1 (AAH06337, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (41.36 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of AP2S1 expression in transfected 293T cell line by AP2S1 monoclonal antibody (M01), clone 3E4.
Lane 1: AP2S1 transfected lysate(17 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged AP2S1 is 0.3 ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of AP2S1 over-expressed 293 cell line, cotransfected with AP2S1 Validated Chimera RNAi ( Cat # H00001175-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with AP2S1 monoclonal antibody (M01), clone 3E4 (Cat # H00001175-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — AP2S1
Entrez GeneID
1175GeneBank Accession#
BC006337Protein Accession#
AAH06337Gene Name
AP2S1
Gene Alias
AP17, AP17-DELTA, CLAPS2
Gene Description
adaptor-related protein complex 2, sigma 1 subunit
Omim ID
602242Gene Ontology
HyperlinkGene Summary
One of two major clathrin-associated adaptor complexes, AP-2, is a heterotetramer which is associated with the plasma membrane. This complex is composed of two large chains, a medium chain, and a small chain. This gene encodes the small chain of this complex. Alternative splicing has been observed in this gene and results in two known transcripts. [provided by RefSeq
Other Designations
clathrin assembly protein 2 small chain|clathrin-associated/assembly/adaptor protein, small 2 (17kD)
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com