Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AP1S1 (Human) Recombinant Protein (P01)

  • Catalog # : H00001174-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human AP1S1 full-length ORF ( AAH03561, 1 a.a. - 133 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSTFPFSH
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 40.37
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001174-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1174
  • Gene Name:
  • AP1S1
  • Gene Alias:
  • AP19,CLAPS1,FLJ92436,SIGMA1A,WUGSC:H_DJ0747G18.2
  • Gene Description:
  • adaptor-related protein complex 1, sigma 1 subunit
  • Gene Summary:
  • The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. [provided by RefSeq
  • Other Designations:
  • AP-1 complex subunit sigma-1A,HA1 19 kDa subunit,clathrin assembly protein complex 1 sigma-1A small chain,clathrin coat assembly protein AP19,clathrin-associated/assembly/adaptor protein, small 1 (19kD),golgi adaptor HA1/AP1 adaptin sigma-1A subunit,sigma
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook