Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AP1S1 purified MaxPab mouse polyclonal antibody (B02P)MaxPab

  • Catalog # : H00001174-B02P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human AP1S1 protein.
  • Immunogen:
  • AP1S1 (NP_001274.1, 1 a.a. ~ 158 a.a) full-length human protein.
  • Sequence:
  • MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of AP1S1 expression in transfected 293T cell line (H00001174-T03) by AP1S1 MaxPab polyclonal antibody.

    Lane 1: AP1S1 transfected lysate(18.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Entrez GeneID:
  • 1174
  • Gene Name:
  • AP1S1
  • Gene Alias:
  • AP19,CLAPS1,FLJ92436,SIGMA1A,WUGSC:H_DJ0747G18.2
  • Gene Description:
  • adaptor-related protein complex 1, sigma 1 subunit
  • Gene Summary:
  • The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. [provided by RefSeq
  • Other Designations:
  • AP-1 complex subunit sigma-1A,HA1 19 kDa subunit,clathrin assembly protein complex 1 sigma-1A small chain,clathrin coat assembly protein AP19,clathrin-associated/assembly/adaptor protein, small 1 (19kD),golgi adaptor HA1/AP1 adaptin sigma-1A subunit,sigma
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook