AP1S1 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of AP1S1 expression in transfected 293T cell line (H00001174-T03) by AP1S1 MaxPab polyclonal antibody.
Lane 1: AP1S1 transfected lysate(18.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human AP1S1 protein.
Immunogen
AP1S1 (NP_001274.1, 1 a.a. ~ 158 a.a) full-length human protein.
Sequence
MMRFMLLFSRQGKLRLQKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSKKSVLKAIEQADLLQEEDESPRSVLEEMGLA
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of AP1S1 expression in transfected 293T cell line (H00001174-T03) by AP1S1 MaxPab polyclonal antibody.
Lane 1: AP1S1 transfected lysate(18.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — AP1S1
Entrez GeneID
1174GeneBank Accession#
NM_001283Protein Accession#
NP_001274.1Gene Name
AP1S1
Gene Alias
AP19, CLAPS1, FLJ92436, SIGMA1A, WUGSC:H_DJ0747G18.2
Gene Description
adaptor-related protein complex 1, sigma 1 subunit
Omim ID
603531Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. [provided by RefSeq
Other Designations
AP-1 complex subunit sigma-1A|HA1 19 kDa subunit|clathrin assembly protein complex 1 sigma-1A small chain|clathrin coat assembly protein AP19|clathrin-associated/assembly/adaptor protein, small 1 (19kD)|golgi adaptor HA1/AP1 adaptin sigma-1A subunit|sigma
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com