Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

AP1S1 polyclonal antibody (A01)

  • Catalog # : H00001174-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length recombinant AP1S1.
  • Immunogen:
  • AP1S1 (AAH03561, 1 a.a. ~ 133 a.a) full-length recombinant protein with GST tag.
  • Sequence:
  • MMRFMLLFSRQGKLRLRKWYLATSDKERKKMVRELMQVVLARKPKMCSFLEWRDLKVVYKRYASLYFCCAIEGQDNELITLELIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLMGGDVQDTSTFPFSH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00001174-A01
    Western Blot detection against Immunogen (40.74 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Entrez GeneID:
  • 1174
  • Gene Name:
  • AP1S1
  • Gene Alias:
  • AP19,CLAPS1,FLJ92436,SIGMA1A,WUGSC:H_DJ0747G18.2
  • Gene Description:
  • adaptor-related protein complex 1, sigma 1 subunit
  • Gene Summary:
  • The protein encoded by this gene is part of the clathrin coat assembly complex which links clathrin to receptors in coated vesicles. These vesicles are involved in endocytosis and Golgi processing. This protein, as well as beta-prime-adaptin, gamma-adaptin, and the medium (mu) chain AP47, form the AP-1 assembly protein complex located at the Golgi vesicle. [provided by RefSeq
  • Other Designations:
  • AP-1 complex subunit sigma-1A,HA1 19 kDa subunit,clathrin assembly protein complex 1 sigma-1A small chain,clathrin coat assembly protein AP19,clathrin-associated/assembly/adaptor protein, small 1 (19kD),golgi adaptor HA1/AP1 adaptin sigma-1A subunit,sigma
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook