Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CKS2 (Human) Recombinant Protein (Q01)

  • Catalog # : H00001164-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CKS2 partial ORF ( NP_001818, 1 a.a. - 79 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 34.43
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00001164-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Entrez GeneID:
  • 1164
  • Gene Name:
  • CKS2
  • Gene Alias:
  • CKSHS2
  • Gene Description:
  • CDC28 protein kinase regulatory subunit 2
  • Gene Summary:
  • CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq
  • Other Designations:
  • CDC28 protein kinase 2,CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2,OTTHUMP00000021616
  • RSS
  • YouTube
  • Linkedin
  • Facebook