CKS2 monoclonal antibody (M01), clone 2H5-2C4
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CKS2 expression in transfected 293T cell line by CKS2 monoclonal antibody (M01), clone 2H5-2C4.
Lane 1: CKS2 transfected lysate(9.9 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CKS2 is approximately 3ng/ml as a capture antibody.
Immunofluorescence
Immunofluorescence of monoclonal antibody to CKS2 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (34.43 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant CKS2.
Immunogen
CKS2 (AAH06458, 1 a.a. ~ 79 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (99); Rat (99)
Isotype
IgG2b kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.43 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CKS2 expression in transfected 293T cell line by CKS2 monoclonal antibody (M01), clone 2H5-2C4.
Lane 1: CKS2 transfected lysate(9.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CKS2 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to CKS2 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — CKS2
Entrez GeneID
1164GeneBank Accession#
BC006458Protein Accession#
AAH06458Gene Name
CKS2
Gene Alias
CKSHS2
Gene Description
CDC28 protein kinase regulatory subunit 2
Omim ID
116901Gene Ontology
HyperlinkGene Summary
CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq
Other Designations
CDC28 protein kinase 2|CKS1(S. cerevisiae Cdc28/Cdc2 kinase subunit) homolog-2|OTTHUMP00000021616
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com