CKMT1B monoclonal antibody (M04), clone 2C8
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CKMT1B.
Immunogen
CKMT1B (NP_066270, 327 a.a. ~ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH
Host
Mouse
Reactivity
Human
Interspecies Antigen Sequence
Mouse (93); Rat (92)
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.75 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CKMT1B monoclonal antibody (M04), clone 2C8. Western Blot analysis of CKMT1B expression in A-431 ( Cat # L015V1 ).Western Blot (Transfected lysate)
Western Blot analysis of CKMT1B expression in transfected 293T cell line by CKMT1B monoclonal antibody (M04), clone 2C8.
Lane 1: CKMT1B transfected lysate(47 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CKMT1B is approximately 0.1ng/ml as a capture antibody.ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CKMT1B over-expressed 293 cell line, cotransfected with CKMT1B Validated Chimera RNAi ( Cat # H00001159-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CKMT1B monoclonal antibody (M04), clone 2C8 (Cat # H00001159-M04 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. -
Gene Info — CKMT1B
Entrez GeneID
1159GeneBank Accession#
NM_020990Protein Accession#
NP_066270Gene Name
CKMT1B
Gene Alias
CKMT, CKMT1, UMTCK
Gene Description
creatine kinase, mitochondrial 1B
Omim ID
123290Gene Ontology
HyperlinkGene Summary
Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq
Other Designations
OTTHUMP00000066275|acidic-type mitochondrial creatine kinase|creatine kinase, mitochondrial 1 (ubiquitous)|ubiquitous mitochondrial creatine kinase
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com